What Can I Say Instead Of Another?

What can I say instead of another thing?

What is another word for another thing?additionallyfurtheranotheras an extraas a bonuscomparativelythusjointlyconjointlyidentically44 more rows.

What’s another way to say each other?

What is another word for each other?one anotherallevery last oneall and sundryoneeach and every oneeach oneeachone and allboth5 more rows

What is another word for scared?

What is another word for scared?frightenedafraidpanickyagitatedalarmedworriedintimidatedterrifiedpetrifiedhorrified229 more rows

What are the transitional words and phrases?

Common Transitional Words and Phrasescause and effect: consequently, therefore, accordingly, as a result, because, for this reason, hence, thus.sequence: furthermore, in addition, moreover, first, second, third, finally, again, also, and, besides, further, in the first place, last, likewise, next, then, too.More items…

What is it called when you use an example to explain something?

An analogy is using an example to explain something else by showing how the two situations are similar. Not a full blown story like allegory, but more elaborate than a metaphor, in which a non-literal meaning is expressed in a single word or short phrase.

What do you call an example of something?

exemplar. noun. formal a perfect or typical example of something.

How do you use each other in a sentence?

Jane loves Mark.We can say: “Mark and Jane love each other.” “each other” is a reciprocal pronoun. … Mark and Jane gave each other gifts. Mark and Jane gave one another gifts. … Possessive adjectives with “each other” and “one another” … Mark and Jane helped each other. … Example of mistake: … Examples of mistake:

What’s another way to say another?

Another Synonyms – WordHippo Thesaurus….What is another word for another?secondadditionalfreshnewsupplementalsupplementaryothermorefartherspare35 more rows

What’s another word for another example?

What is another word for another example?specimensampleexemplificationinstancerepresentationcaserepresentativesamplingexemplarexhibit55 more rows

What does each other’s mean?

The answer is: Both forms are common. Since “each other’s” basically means “(mutually) the other person’s”, and we wouldn’t say “the other person’s faces” (unless the other person is two-faced), it makes more sense to say “each other’s face”.

What can I say instead of this show?

What is another word for this shows that?this demonstrates thatthis proves thatthis confirms thatthis corroborates thatthis validates thatthis verifies that

What is another word for staff?

What is another word for staff?personnelworkforceteamunderlingworkmenassistantsattendantscadrecorpsdeputies68 more rows

What is a fancy word for stuff?

What is another word for stuff?equipmentapparatusresourcespossessionsstockrubbishjunkdunnagenecessarycontrivances130 more rows

What is a Gubbins?

1 dialectal, British : fish parings or refuse broadly : any bits and pieces : scraps. 2 British : gadgets, gadgetry the gubbins for changing a tire all the navigational gubbins— J. L. Rhys. 3 British : a foolish or futile person : simpleton you silly gubbins.